Protein Info for ABZR87_RS17190 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 368 (345 residues), 143.6 bits, see alignment E=7.4e-46 PF00083: Sugar_tr" amino acids 50 to 189 (140 residues), 63.4 bits, see alignment E=2e-21 amino acids 222 to 413 (192 residues), 36 bits, see alignment E=4e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_4045)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ABZR87_RS17190 MFS transporter (Ralstonia sp. UNC404CL21Col)
MFGWFKEISKGEKRTFWACFGGWALDALDVQMFSLVIPTIISAWHIGKAEAGLVSGVTLV
ASALGGWIAGALTDRFGRVRTLQITVLWFSLATFASAFAQNFEQFLVLKAIQGFGFGGEW
AAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYSFIEPDLAWRVMFAAGLL
PALLIIYIRRGVKEPVPAAKPDANANAMPISRFPLLDIFRPQVLRMTLIGGLLGVGAHGG
YYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGCVASAWLLDVLGRRGNILLFSCC
CVVTVLVYLLVPLSDGAMLVLGFPLGFFAAGIPASMGALFNELYPQGVRGTGVGFCYNFG
RVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVAVAVLMLPETKGRDLAAVTV