Protein Info for ABZR87_RS17180 in Ralstonia sp. UNC404CL21Col

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF13489: Methyltransf_23" amino acids 32 to 187 (156 residues), 56.8 bits, see alignment E=9.2e-19 PF05175: MTS" amino acids 36 to 163 (128 residues), 28.5 bits, see alignment E=4.6e-10 PF01209: Ubie_methyltran" amino acids 40 to 155 (116 residues), 76.3 bits, see alignment E=9.6e-25 PF13847: Methyltransf_31" amino acids 42 to 182 (141 residues), 75.6 bits, see alignment E=1.4e-24 PF13649: Methyltransf_25" amino acids 45 to 138 (94 residues), 79.8 bits, see alignment E=8e-26 PF08241: Methyltransf_11" amino acids 46 to 142 (97 residues), 86.1 bits, see alignment E=8.5e-28 PF08242: Methyltransf_12" amino acids 46 to 140 (95 residues), 57.7 bits, see alignment E=6.5e-19

Best Hits

Swiss-Prot: 47% identical to YAFE_ECOLI: Uncharacterized protein YafE (yafE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_4043)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>ABZR87_RS17180 class I SAM-dependent methyltransferase (Ralstonia sp. UNC404CL21Col)
MQQHRLVDQQFGQVAQAYLTSAVHAQGADLDALAALAQSVPHAKVLDLGCGGGHVSFAMA
PHVATMVAYDLSEDMLSVVAAEAARRGLAQLHTQAGRAERLPFDDAAFDIVATRFSAHHW
YDVRKGLAEARRVLKPGGTLVVVDIVAPEVPLLDTLLQTAEVLRDASHVRDYRVSEWQAM
LVEAGFQPGTPRTWKLTMAFDSWIARIRTPQVRADAIRDLFDRAADEARAYFAVAPDHSF
AIDAMLIEAT