Protein Info for ABZR87_RS17025 in Ralstonia sp. UNC404CL21Col

Annotation: FAD-containing oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF07992: Pyr_redox_2" amino acids 6 to 321 (316 residues), 198.8 bits, see alignment E=4.2e-62 PF00070: Pyr_redox" amino acids 172 to 247 (76 residues), 66.3 bits, see alignment E=9e-22 PF02852: Pyr_redox_dim" amino acids 345 to 450 (106 residues), 80.1 bits, see alignment E=4.3e-26

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 96% identity to rpi:Rpic_3897)

Predicted SEED Role

"PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>ABZR87_RS17025 FAD-containing oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTQRFDAIIIGTGQAGPPLAARLSGAGMKVAIVERGRFGGTCVNTGCIPTKAMVASAYAA
RMAQRAAEYGVMIDGGVTVDMQRVKARKDEISGRSSHGVEQWVRGLEHCTVFQGHARFES
ARTVRVGDALLEAERIFINVGGRALVPPMPGLDQVPFLTNSTMMDVDFLPEHLVVIGGSY
VGLEFGQMFRRFGSRVTIVEKGPRLIAREDEDVSQAVREILEAEGIDVQVNADCLSVRRD
GANVVVGLECGSGAREVSGSHLLMAVGRVPNTDDLGLDKAGVQTDKRGNIVVDDQLRTNV
PGIWALGDCNGRGAFTHTAYNDYEIVAANLLDDDPRKVSDRIQAYAMYIDPPLARVGMSL
SEAKQSGRKLLVGNRPMTRVGRAVEKGESQGFMRVVVDAQTHEILGASILGVGGDEAVHS
ILDVMYAKAPYTTISRAMHIHPTVSELIPTLLQSMEPVQ