Protein Info for ABZR87_RS16895 in Ralstonia sp. UNC404CL21Col

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 136 to 152 (17 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF13515: FUSC_2" amino acids 49 to 176 (128 residues), 52.5 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: None (inferred from 90% identity to rpi:Rpic_3878)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>ABZR87_RS16895 FUSC family protein (Ralstonia sp. UNC404CL21Col)
MSISLRAPRTVKLPAPFLSLLRLVRDPHRRYRHARYIHATRVGLGVLLSIAVTAGFGWPH
GEWATISLLIVIAGLQHHGNIRKRAAERAWGTLIGAVAGLLIIVQQTWLGHLPLTYALTA
MACGICAYHAIGRGGYIALLAAITLVIVVGHGDNNLLDGAWRTLNVLVGIAIALLFSFAL
PLYATYSWRYRLADALRECARAYANLGQAGDAPSERSKQLGKLNTLLVQLRSLMPSVSKE
IDVPLERLENIQRSLRICISTLELLNATRGAPGQPSPAALPAAGAGARRIRDTLIGMSRA
LRFGTLARLARPRAADSADVSHAPGTPTVESALADGFANEIDNLRRQLLAIAPQWNIG