Protein Info for ABZR87_RS16870 in Ralstonia sp. UNC404CL21Col

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF13185: GAF_2" amino acids 15 to 151 (137 residues), 41.4 bits, see alignment E=2.6e-14 PF01590: GAF" amino acids 16 to 153 (138 residues), 33.3 bits, see alignment E=1e-11 PF00563: EAL" amino acids 170 to 390 (221 residues), 159.7 bits, see alignment E=1.3e-50

Best Hits

KEGG orthology group: None (inferred from 47% identity to psa:PST_3107)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>ABZR87_RS16870 EAL domain-containing protein (Ralstonia sp. UNC404CL21Col)
MEDFLAGSLVPPDAEAEELITQIVRTVRTHLGMPFAFVSEFVGGQRVFRYVDSGVEPSPL
RVGRSDPLAESFCIRVAEGRLPRLIHDATQLQGWELPPTPAIQVGAHISVPVQRADGSIF
GMFCCFSDRSDHSLNSRDLELMSAFSKVISRQIERHHQAKRELSEKHARVSSVIEHDNLT
VVFQPIRSLVDSQLVGLEVLSRFPGGQDRPPYLWFSDAWEAGLGAELEMLAIRKGLRALP
TFPDLYLAVNASPGTILTGKLEAMFENVPADRVVLEITEHALVEDYPDLQSALRPLRTKS
VRIAIDDAGSGYATMRHIVELKPDLIKLDARLTTNLQHDATKRALVKAMVTFASEIRCDL
IAEGIEDPDQKSLLVDLGVRKGQGYLLGRPGPLPAVTPQTSPSIIEAQRRVK