Protein Info for ABZR87_RS16750 in Ralstonia sp. UNC404CL21Col

Annotation: propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 9 to 646 (638 residues), 861.5 bits, see alignment E=1.1e-263 PF06506: PrpR_N" amino acids 34 to 198 (165 residues), 167 bits, see alignment E=9.2e-53 PF00158: Sigma54_activat" amino acids 328 to 495 (168 residues), 231.5 bits, see alignment E=1.4e-72 PF14532: Sigma54_activ_2" amino acids 329 to 500 (172 residues), 67.7 bits, see alignment E=3.9e-22 PF07728: AAA_5" amino acids 352 to 471 (120 residues), 26.1 bits, see alignment E=2.4e-09 PF02954: HTH_8" amino acids 611 to 646 (36 residues), 39.4 bits, see alignment 1.2e-13

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 96% identity to rpi:Rpic_3862)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>ABZR87_RS16750 propionate catabolism operon regulatory protein PrpR (Ralstonia sp. UNC404CL21Col)
MSPTATDLTDRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRGFEDIVREIDAAGADR
PDVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARRDAESVALVTHGDTPEEVRR
FVAAYGMDVVFASYTSRQGAESCVLDLRDRGVGVVVGPGLVTDLATQAGMNAVFLYSRDS
VRAAFDTALEVVQATRRETLRRQRLDNLLQHLRDGVVALDAQGRVEAINQRLATALGIEA
KLAIGQPLLSIAPNLLGLLPDSDGDTLGTVQGVNYVIHRGPLASAGAGAPEGTVFTFQES
RAVERLDRTLRSRQRPQQFSARYRLEDLVGESLPMERVRTLVRRYAKSDATVLVLGESGT
GKEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFGYEEGAFTGARKGGKTGLIEAA
HRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTDAVEAG
TFRADLYYRLNILSIALPSLRERPDDVMPLAAELLVQAARREPRLLLRIADTEDATRVLA
GIAEPLRRYTWAGNVRELQSVVERIAVELAYTDDTDAITQDVLRLIAPEVFAHATAGKPA
AQTLRERSRGVEAEEIRAALAAHGGNRDAVCAALGISKTTLWRRLQMG