Protein Info for ABZR87_RS16685 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 380 (359 residues), 130.4 bits, see alignment E=3.8e-42

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_3852)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABZR87_RS16685 MFS transporter (Ralstonia sp. UNC404CL21Col)
MQRLARLIAPRFHYSWLALAVVFLILLCAAGTRATPSVMMLPLEHEFGWSRSTISLAISI
GIALYGLTGPFAAASMQYFGIRPTVLGALAVLVAGTALSAMMHEPWQMVLLWGVMVGGGT
GVAAITLGATVVNRWFTSHRGLAMGILTASSATGQLVFLPMMAAVVEHYGWRPVVLIVAS
VLALLLPVVWLLLPESPKSVGLRTYGEPADAPEADHGPRANPITLAMQTLVQAARKRDFW
LLFASFFICGASTNGYIGTHFIAMCADHGFSEVKGASLLAAMGIFDLVGTTLSGWLSDRY
NSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAVFYGLDWIATVPPTVRLTNDVFGKA
AAPIVFGWIVAGHQLGAAFATLGAGMMRASLGNYTLASMISGGLCVAGAFLVLRIHRTPK
KDAERAGQPATA