Protein Info for ABZR87_RS16680 in Ralstonia sp. UNC404CL21Col

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13531: SBP_bac_11
  • amino acids 32 to 254 (223 residues), 201.1 bits, E=3.5e-63
• TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein
  • amino acids 37 to 253 (217 residues), 200.3 bits, E=1.9e-63
• PF01547: SBP_bac_1
  • amino acids 37 to 247 (211 residues), 81.4 bits, E=1.8e-26
• PF04069: OpuAC
  • amino acids 52 to 207 (156 residues), 25.7 bits, E=1.3e-09

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 89% identity to rpf:Rpic12D_3965)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Protein Sequence (257 amino acids)

>ABZR87_RS16680 molybdate ABC transporter substrate-binding protein (Ralstonia sp. UNC404CL21Col)
MQRFSVRAHVRAIGLVAALSMGFAAPARAADLVVSAAASLTNAFKTIAQQYEALHPDTKV
VLNFGASDVLMQQIVKGAPADVFASADQEAMNKAAAEKVIKTETRHDFVANQLVLIVPAA
GTVPVHALADLTRPDVKRVAIGNPASVPVGRYAKRALEAAKLWEPVEAKAVLAQNVRQAL
DYVSRGEVEAGLVFSTDAAIAADKVKVASPVPLNVPLTYPIAVTSGTKQPQQAADFVAYV
LSPAGQAVLGKYGFLKP