Protein Info for ABZR87_RS16635 in Ralstonia sp. UNC404CL21Col

Annotation: MFS family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 219 (197 residues), 79.7 bits, see alignment E=2.3e-26 amino acids 230 to 421 (192 residues), 43.2 bits, see alignment E=2.7e-15 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 28 to 414 (387 residues), 446.3 bits, see alignment E=5.2e-138 PF07690: MFS_1" amino acids 66 to 275 (210 residues), 54.3 bits, see alignment E=1.1e-18 amino acids 277 to 428 (152 residues), 45.2 bits, see alignment E=6.4e-16

Best Hits

Swiss-Prot: 67% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 91% identity to rpf:Rpic12D_3958)

MetaCyc: 67% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"dicarboxylic acid transporter PcaT" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ABZR87_RS16635 MFS family transporter (Ralstonia sp. UNC404CL21Col)
MDSTATPHAVDPHDTRRRIFAIVGASSGNLVEWFDFYVYAFSSLYFAPAFFPSGDRTTQL
LNTAGVFAAGFLMRPIGGWLFGRIADRHGRRTAMMISVLMMCGGSLLIAVLPTYAQIGAL
APFLLLVARLFQGLSVGGEYGTSATYMSEVALQGRRGFFASFQYVTLIGGQLCAVLVLVI
LQQLLTTAELKAWGWRIPFVVGALTALIALYLRKSLHETQTTSARKVEHAGTIRGAWQHK
GAFLRVIGFTAGGSLIFYTFTTYMQKYLVNTAHMETKTASNVMTGALFVYMILQPVFGAL
SDRIGRRNSMLLFGALSVLGTVPLMNALATVSTPLAAFGLITLALAIVSFYTSISGLIKA
EMFPPEVRAMGVGLSYAIANAVFGGSAEYVALWFKQAGSESTFYWYVTALCAVSFIVTYF
MPDPSKEGYLRHEP