Protein Info for ABZR87_RS16590 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 344 to 384 (41 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 516 to 537 (22 residues), see Phobius details amino acids 549 to 576 (28 residues), see Phobius details amino acids 588 to 605 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 281 (269 residues), 148 bits, see alignment E=1.5e-47 amino acids 337 to 600 (264 residues), 150.8 bits, see alignment E=2.2e-48

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein K01998, branched-chain amino acid transport system permease protein (inferred from 73% identity to azl:AZL_a01330)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) / Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>ABZR87_RS16590 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MESLLHGAWLDYTVNGLVVGNIYALLAVGLALIFGVSHLINFAHGSVYTVGAFIGWFAIT
HLHAPLWVTIALVIVGSALLGMGIERVGLRPLANAPRIAPLLATIGLSYVIDQAVQLLAG
PDPRALPNPLPDWRLTLGGGSIGALDVLIAALGLASATVLFVFLRYTRLGWAVRATAQDR
DAARQMGVSTHAVNQAVFAIASALGGLSGLLVGMYYNNISPAMSFQATLKGVVAVVIGGV
GNVPGAIAGSLLLGLTESYGVALFGTPYRNLFAFLLLVGVLVWRPNGLFARKPALSPEPL
TGTFIAPSRPINVPRWVWPVAIAVLAVVPLTGVSSYVVQVLTNAWLYALLALSLTLVAGT
AGQISLGHAGLLAIGAYASALLAIDAQVPVLLAVLLAGVVTAALGTLLVLPAFRLRGHYV
SIATLGIGEIIALVILNWESVTRGPIGVAGIPPLAAGNFALDSAAAFYWVGLAAVVALGL
LQRRLLGTHLGRTLRAIREDDVAARAYGVSPARYKALAFGVGGFLAGVAGALTAHLYSYI
NHETFGSPISILALTMVILGGLGSVAGAVIGAVALVGLPELFRVTAEYRILIVGLTLLLL
VRFRPQGLLGTV