Protein Info for ABZR87_RS16430 in Ralstonia sp. UNC404CL21Col

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 35 to 425 (391 residues), 374.2 bits, E=3.6e-116
• PF03446: NAD_binding_2
  • amino acids 35 to 156 (122 residues), 24.8 bits, E=5.2e-09
• PF03721: UDPG_MGDP_dh_N
  • amino acids 35 to 208 (174 residues), 125.4 bits, E=5.1e-40
• PF00984: UDPG_MGDP_dh
  • amino acids 227 to 315 (89 residues), 85.3 bits, E=6.5e-28
• PF03720: UDPG_MGDP_dh_C
  • amino acids 343 to 444 (102 residues), 67.9 bits, E=2.2e-22

Best Hits

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 53% identity to gwc:GWCH70_3259)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.22

Protein Sequence (456 amino acids)

>ABZR87_RS16430 nucleotide sugar dehydrogenase (Ralstonia sp. UNC404CL21Col)
MSRGGESTFAENLFIKPAPRWPDPITPAVEPATVKIAVVGLGYVGAPLAVAFSKHFAVSG
LDIDATRVAELTEGRDRTNELTGNELLESGARFTTDATVLGQADVIVVTVPTPVDQARVP
DLNPVMQASISVGKHMKRGAVVVYESTVYPGVTEEICIPLLERHSGLKHLKDFHVGYSPE
RINPGDRVHTLTTMTKIVAGDTPETLQALVSLYGAVTQVHPAKSIKVAEAAKVLENTQRD
VNIALMNEVSQLLAALGVDTHDVLAAARSKWNFLDFRPGLVGGHCISVDPYYLTHKAASC
GFNASLILAARETNDSMSQFVVDQLMRRMTQCHLLGPHTLVTILGTTFKEDVPDIRNSKV
ADIVKKLGALGIRTQVIDPLADSNEVAHEYGFRLTRLADAKAADAIVLAVPHTEYREGGW
ALVESLARPGSPFVVSDLKAVLDRDACPDRAVLWRP