Protein Info for ABZR87_RS16415 in Ralstonia sp. UNC404CL21Col

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01583: APS_kinase" amino acids 5 to 159 (155 residues), 195 bits, see alignment E=4e-62 TIGR00455: adenylyl-sulfate kinase" amino acids 5 to 168 (164 residues), 197.8 bits, see alignment E=6.2e-63

Best Hits

Swiss-Prot: 50% identical to CYSC_SYNJA: Adenylyl-sulfate kinase (cysC) from Synechococcus sp. (strain JA-3-3Ab)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 68% identity to rsc:RCFBP_10261)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>ABZR87_RS16415 adenylyl-sulfate kinase (Ralstonia sp. UNC404CL21Col)
MQPTPSTLWLTGLSAAGKTTLALAVAETLTSRGLPCRVLDGGALRQQLCADLGFSRADRS
EHARRVAQWCAQMNNTGTWAVAALISPYREDRERARQIVGASRFFEVHVATPLAVCESRD
PKGLYRMARAGTIANLTGVGEPYEPPLHPQLMVDTGVQSVEACVAQALALLGMQEAVAA