Protein Info for ABZR87_RS16375 in Ralstonia sp. UNC404CL21Col

Annotation: Fe2+-dependent dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF13640: 2OG-FeII_Oxy_3" amino acids 85 to 179 (95 residues), 54.3 bits, see alignment E=2.1e-18 PF18331: PKHD_C" amino acids 185 to 227 (43 residues), 65.8 bits, see alignment 2.9e-22

Best Hits

Swiss-Prot: 80% identical to Y2877_CUPNJ: PKHD-type hydroxylase Reut_A2877 (Reut_A2877) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 99% identity to rpf:Rpic12D_3916)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABZR87_RS16375 Fe2+-dependent dioxygenase (Ralstonia sp. UNC404CL21Col)
MLVCIPNVFNAAQVAALRDLLDNAGDAWVDGRVSAGYSGAPVKVNQQIDEGAEVALQCQQ
LILSVLERHPRFISAALPNVVYPPMFNRYGEGMTFGAHVDGSVRIHPHNGTKLRTDISAT
LFLSDPASYDGGELQIEDTYGMHSVKLNAGDLVIYPATSLHQVTPITRGVRVASFFWIQS
LIRDDAQRAMLFDLDNAIQTLNQTDADATARRTLIGVYHNLMRQWSET