Protein Info for ABZR87_RS16365 in Ralstonia sp. UNC404CL21Col

Annotation: ClcB-like voltage-gated chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 176 to 191 (16 residues), see Phobius details amino acids 200 to 227 (28 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 103 to 431 (329 residues), 291.5 bits, see alignment E=4.8e-91

Best Hits

Swiss-Prot: 91% identical to CLCL_RALSO: Putative chloride channel protein ClcB-like (RSp0020) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 89% identity to rpi:Rpic_3801)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>ABZR87_RS16365 ClcB-like voltage-gated chloride channel protein (Ralstonia sp. UNC404CL21Col)
MTDTPPPQPDMPRQPWWRRAIARLPFGREHLVFVIAGLIGCAGALSTILFRECLRQLQWW
LSGTDQGLVATARALPWWARLLVPTVGGLLAGITLQVGLKWIPRKGAEDYMEAIAVGDGV
LSARQSLVRSASSLCSVASGASIGREGPMVQLAAMCGSLVGRVLRHWTAVPVEQLRLLVA
CGAAAGITSAYNAPISGAVFVCEIVFGVITTATLGPLLVAAVTADIVVRQFFGYGAVYEM
PHFDFVSGWEVLTYVGLGLAAGMAGPLLLGLIDRARDAFARTKLPLTLRLAAGGLIVGAL
STGVPEVWGNGYSVVNAFLHEPWLWQTVALVLICKVVATASSAGSGAVGGVFTPTLFCGA
ALGLLYGTGMHALLPDAAPVPVSYAVVGMGALLAATTHAPLMSILMIFEMTLSYQVVLPL
MLACITGYVTAHAARAPSVYARALARNREDTGDNAGHLPASSDGTQK