Protein Info for ABZR87_RS16305 in Ralstonia sp. UNC404CL21Col

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF00072: Response_reg" amino acids 17 to 126 (110 residues), 96.7 bits, see alignment E=2.9e-31 PF00158: Sigma54_activat" amino acids 154 to 319 (166 residues), 228.7 bits, see alignment E=1.1e-71 PF14532: Sigma54_activ_2" amino acids 155 to 324 (170 residues), 70 bits, see alignment E=7.6e-23 PF07728: AAA_5" amino acids 177 to 293 (117 residues), 23.3 bits, see alignment E=1.7e-08 PF02954: HTH_8" amino acids 404 to 441 (38 residues), 40.4 bits, see alignment 5.8e-14

Best Hits

Swiss-Prot: 53% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 96% identity to rpf:Rpic12D_3902)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABZR87_RS16305 sigma-54 dependent transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MTEHGTPDPSPIDHAPVFLIEDDDVVRLGCEQALSLADVPVQSFADAESALAALATQTPA
VVVTDVRLPGRDGLAVLREMLQHDRQLPVILITGHGDVTMAVAAMRAGAYDFMEKPFHSE
RLVDVVRRALEKRRLTSENLRLREALQGRQAYPLIGQSAVMQNVRRLVTALAPTDADILV
TGETGSGKEVLARAIHEGSRRRGPFVALNCAALPESVFESEMFGHEAGAFTGANRRRIGK
MEYADGGTLFLDEIESMPLALQAKLLRALQERSIERLGSNASVPVNCRVVAAAKVDLKEA
SDHGQFRADLYYRLNVVSIALPALRQRAEDIPLLMAHFLQQAAVRYERPAPDWSAQDMMR
WQHHDWPGNVRELKNVAERFCLGLDDGLVASESSQHSLAGRMMAVERATIEEALRATEGN
VARAADLLAVPRKTLYDKLNRHGIEPDRFRSS