Protein Info for ABZR87_RS16300 in Ralstonia sp. UNC404CL21Col

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details PF02743: dCache_1" amino acids 61 to 307 (247 residues), 61.2 bits, see alignment E=1.7e-20 PF00512: HisKA" amino acids 411 to 476 (66 residues), 30.1 bits, see alignment E=6.1e-11 PF02518: HATPase_c" amino acids 521 to 632 (112 residues), 80.5 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 88% identity to rpi:Rpic_3788)

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (638 amino acids)

>ABZR87_RS16300 sensor histidine kinase (Ralstonia sp. UNC404CL21Col)
MSPTDGHADLAPPARGRGWRVAVALAMAACCAAAGWGAYAIALQRYVAARAEEAGQRTTF
YAQNLRSTLARYESLPRLAALEHVLHVALLENPEAGDAVPRRAANAYLKEVQAATDLAAA
HLINTTGLTIAASNWDLPTSFVGQNYAFRPYFVEAMREGLGRFYGVGNTTGETGYFVAAP
VREDNTPIGVVVVKVNLDAFEATLSRSGDTVLLVDRHGVIFLSSVPEWKYRTLGTLSADQ
RAALDATRQYAPHILAPLGMNDGQGASVPFSADQPPQTVRVALPGKSVSTLRVQYRPVGL
LGWQVAVLIDPRDEQRTALVAGASAAFAMALIFAVLVALRLRQRRREEQHRARAALREVQ
RDLEARIAQRTAELTSANTALAGKVEALDAAQRILRETRDAAVQAGKLAVLGQMAAGITH
ELNQPLTALTTLSDNANQLAERGRIDEVRGNLTHISQLAERMGRIVSHIKAFSRKGDAAR
AAVSVDEAIRQALMLIETRRRQAGVTVVIEPVPADLAVWANAVRLEQVLVNLIRNAIDAT
AEAPAAGSAIVRVSVEAIEKWVRITVRDCGPGIPADVLPRLFEPFFTTKDDGQGLGLGLA
ISLAIIEDFGGRLEGRNASDGTPGAEFIIELERVVKPT