Protein Info for ABZR87_RS16295 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 38 to 244 (207 residues), 105.9 bits, see alignment E=2.6e-34 amino acids 234 to 440 (207 residues), 43.6 bits, see alignment E=1.9e-15 PF07690: MFS_1" amino acids 40 to 275 (236 residues), 61 bits, see alignment E=1e-20 amino acids 268 to 441 (174 residues), 48.6 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 52% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 94% identity to rpi:Rpic_3787)

MetaCyc: 52% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>ABZR87_RS16295 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTQPQAGAVTGELSPTHAPTKDTPADVRRRLRSIFSGSVGNLVEWYDWYVYSAFALYFAK
SFFPKGDQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYGRKRALFFSVVLMCAGSLII
ALTPSYATIGVAAPVLLVLARLLQGLSVGGEYGTSATYLSEVANKENRGFYSSFQYVTLI
AGQLTALALLIVLQQFVLSPAQLEAWGWRIPFFIGALCALVAMRMRSHMEETQSFTAAKA
NKKRGTLSELAKHPRAVATVVGLTMGGTVAFYTYSIYMQKFLANTVGLSKDQATLVSGAT
LLLFAMLQPIVGGLSDRIGRRPILIAFGVLGTLFTVPIMTGISQTTNVWMAFFLIMAALV
IVSGYTSINAVVKAELFPAEVRALGVGLPYALTVSIFGGTAEYIALWLKQAGHESLFYWY
VTGTIFLSLLVYVFMRDTRKHSRIEH