Protein Info for ABZR87_RS16205 in Ralstonia sp. UNC404CL21Col

Annotation: formate dehydrogenase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 124 to 146 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 157 to 363 (207 residues), 169 bits, see alignment E=6.6e-54 PF01292: Ni_hydr_CYTB" amino acids 160 to 341 (182 residues), 68.9 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 95% identity to rpf:Rpic12D_2179)

Predicted SEED Role

"Formate dehydrogenase O gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABZR87_RS16205 formate dehydrogenase subunit gamma (Ralstonia sp. UNC404CL21Col)
MGTSWKHLVMAVLLGSAAALASAQQPASAPAADAAPVNPAVQPAQPFSNIVSENVFDLQK
RDLSKEAHDQAARRAAQPGNNAPVWREVNSDQAHYASIPGLEAGVLIQRTGQKWRLFRNG
VITVWGGWLMVLVPLVILGFFLWRGMIPLKEAPTGRKIERFTPTERYVHWTMAISFVTLG
VSGIVMLWGKHFLLPILGHQLFGWLTYVLKNLHNLVGPLFTVSIIVAFVMWVRDNLPRQG
DVKWLLSLGGMFAGEHGAEVPSHRFNAGEKLWFWGGLVVFGLILSASGWTLDRIVPGVDY
YRSTMQLAEIIHAIAAVGMMCMSLGHIYMGTIGMEGAYRAMRDGYVDEAWAKEHHELWYD
DVKAGKIPAQRSQPPAPPSPSEQPVKS