Protein Info for ABZR87_RS16185 in Ralstonia sp. UNC404CL21Col

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 166 bits, E=3.5e-53
• PF00692: dUTPase
  • amino acids 82 to 183 (102 residues), 25.1 bits, E=6e-10

Best Hits

Swiss-Prot: 99% identical to DCD_RALPJ: dCTP deaminase (dcd) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 98% identity to rso:RSc2366)

MetaCyc: 68% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Protein Sequence (188 amino acids)

>ABZR87_RS16185 dCTP deaminase (Ralstonia sp. UNC404CL21Col)
MSIKSDKWIRRMAEQHGMIEPFEPGQVRESEGRRIVSYGTSSYGYDIRCADEFKIFTNIN
STIVDPKNFDEKSFVDFKGDVCIIPPNSFALARTMEYFRIPRTVLTVCLGKSTYARCGII
VNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGCAQVLFFESDEECETSYKDRGGKYQGQ
HGVTLPKT