Protein Info for ABZR87_RS16135 in Ralstonia sp. UNC404CL21Col

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01379: Porphobil_deam
  • amino acids 26 to 233 (208 residues), 283.4 bits, E=1e-88
• TIGR00212: hydroxymethylbilane synthase
  • amino acids 26 to 320 (295 residues), 341.2 bits, E=2e-106
• PF03900: Porphobil_deamC
  • amino acids 246 to 319 (74 residues), 56.9 bits, E=2.3e-19

Best Hits

Swiss-Prot: 89% identical to HEM3_RALSO: Porphobilinogen deaminase (hemC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 96% identity to rpf:Rpic12D_2166)

MetaCyc: 57% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (20/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Protein Sequence (338 amino acids)

>ABZR87_RS16135 hydroxymethylbilane synthase (Ralstonia sp. UNC404CL21Col)
MSSNARPTPVESQLATTPAAQAPTKLVIASRESRLALWQAEHVRAALQKYYPACDVSILG
MTTRGDQILDRSLAKVGGKGLFVKELEVALAEGRADLAVHSLKDVPMELPEGFALSTILE
REDPRDAFVSNDYADLASLPAGAVVGTSSLRREASLRARFPHLVIQPLRGNLDTRLGKLD
RGDYAAIILAAAGLKRLGLVDRIRSTIAPEESLPAAGQGALGIEIRADREDVRACLAPLH
DAPTALAVTAERAVSRILGGSCQVPLASFAQWSDAGALRLRAFVASQDGTRKLAADGEAT
PSTLAEADALGVRVAQQMLAGGARDILAMLGADAPPAT