Protein Info for ABZR87_RS16085 in Ralstonia sp. UNC404CL21Col

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF13489: Methyltransf_23" amino acids 28 to 134 (107 residues), 31.2 bits, see alignment E=4.4e-11 PF01209: Ubie_methyltran" amino acids 35 to 134 (100 residues), 34.8 bits, see alignment E=2.9e-12 PF13847: Methyltransf_31" amino acids 36 to 134 (99 residues), 36.8 bits, see alignment E=8.5e-13 PF13649: Methyltransf_25" amino acids 41 to 130 (90 residues), 55.8 bits, see alignment E=1.6e-18 PF08241: Methyltransf_11" amino acids 42 to 133 (92 residues), 44.7 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 95% identity to rpf:Rpic12D_2157)

Predicted SEED Role

"Hypothetical Protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>ABZR87_RS16085 class I SAM-dependent methyltransferase (Ralstonia sp. UNC404CL21Col)
MLDYYAKRAPEYERIYTKPERQGDLAWLKARVRDLTRGARVLDLACGTGFWTEAMTDARS
IVGADYNDTVLRIARGKGIAGASFVRADNDALPFAPGTFDVMTAGCWWSHVPLQHLRRHV
EGLHRALGPGVRVLWFDNQYVFGSSTPIAYNDEHGNTWQRRPLRDGSQHDVLKNFPDDPT
LLQTVSGIAEDVRINRLQYYWTLEYFTN