Protein Info for ABZR87_RS16040 in Ralstonia sp. UNC404CL21Col

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 35 to 310 (276 residues), 212.4 bits, E=4.9e-67
• PF00491: Arginase
  • amino acids 38 to 310 (273 residues), 321.5 bits, E=2.7e-100

Best Hits

Swiss-Prot: 72% identical to GBUA_PSEAE: Guanidinobutyrase (gbuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 98% identity to rpf:Rpic12D_2148)

MetaCyc: 74% identical to guanidinobutyrase subunit (Pseudomonas putida)
Guanidinobutyrase. [EC: 3.5.3.7]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• L-arginine degradation X (arginine monooxygenase pathway) (2/3 steps found)
• L-arginine degradation IX (arginine:pyruvate transaminase pathway) (2/4 steps found)
• L-arginine degradation VIII (arginine oxidase pathway) (2/4 steps found)
• L-arginine degradation XII (1/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11 or 3.5.3.7

Protein Sequence (319 amino acids)

>ABZR87_RS16040 agmatinase (Ralstonia sp. UNC404CL21Col)
MNDRADLFQPASGNAMPRFGGIATMMRLPAATSAAGLDACFVGVPFDLGTSNRNGARLGP
RQIRAESVLLRPYNMATRAAPFDSLRVADIGDVPTNPYNLHDSIARIEAAYREIIAGGCR
PIGLGGDHTVTLPILRAMHGKYGRIGLIHVDAHADVNDTMFGEKIAHGTPFRRAVEEGLL
DCNRVVQIGLRGTGYAAEDFDWCREQGFRVVTAEECWHRSLAPLMEEVRARVQGGPVYIS
FDIDGIDPAYAPGTGTPEIGGLTVPQALEIVRGARGLDIVGADLVEVSPPYDPFGTTALL
GANLAFEMLCVLPGVEYRA