Protein Info for ABZR87_RS16030 in Ralstonia sp. UNC404CL21Col

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF05496: RuvB_N" amino acids 7 to 118 (112 residues), 39.3 bits, see alignment E=2.3e-13 PF01078: Mg_chelatase" amino acids 14 to 72 (59 residues), 20.5 bits, see alignment E=1.1e-07 PF07728: AAA_5" amino acids 40 to 118 (79 residues), 23.3 bits, see alignment E=2.2e-08 PF00004: AAA" amino acids 40 to 147 (108 residues), 54.3 bits, see alignment E=8e-18 PF16193: AAA_assoc_2" amino acids 171 to 250 (80 residues), 76.3 bits, see alignment E=7.1e-25 PF12002: MgsA_C" amino acids 251 to 417 (167 residues), 217.6 bits, see alignment E=4.1e-68

Best Hits

Swiss-Prot: 43% identical to Y2559_MYCTU: Uncharacterized AAA domain-containing protein Rv2559c (Rv2559c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07478, putative ATPase (inferred from 99% identity to rpf:Rpic12D_2146)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>ABZR87_RS16030 replication-associated recombination protein A (Ralstonia sp. UNC404CL21Col)
MPLAERLRPHSADDVIGQQHLLGPGKPLRVAFASGEPHSMILWGPPGVGKTTLARLMANA
FDAEFIALSAVLSGVKDIREAVERAEQFRANGRRTLVFVDEVHRFNKSQQDAFLPHVESG
LFTFIGATTENPSFEVNGALLSRAAVYVLKSLSDDELKQLAERARQELGGLEWTPAALDA
IVASADGDGRKLLNNVEIVTRAARAQAEGDTVPVIDEALLASALSENLRRFDKGGDAFYD
QISALHKSVRGSDPDGALYWFCRMLDGGADPRYLARRIVRMAWEDIGLADPRAGRITLDA
AETYERLGSPEGELALAQAVIYLAIAPKSNAGYNAYNAARAFVSQDKSRNVPVHLRNAPT
KLMKELGYGHAYRYAHDEPEAYAAGETYFPDDLSPQNWYVPTPRGLEGKIGEKLRHLREL
DAQWHAQQDKSSRNK