Protein Info for ABZR87_RS15970 in Ralstonia sp. UNC404CL21Col

Annotation: PQQ-dependent methanol/ethanol family dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 25 to 554 (530 residues), 777 bits, see alignment E=4.6e-238 PF13360: PQQ_2" amino acids 72 to 122 (51 residues), 21 bits, see alignment 3.4e-08 amino acids 86 to 224 (139 residues), 52.9 bits, see alignment E=6.5e-18 amino acids 469 to 537 (69 residues), 32.2 bits, see alignment E=1.3e-11 PF01011: PQQ" amino acids 93 to 119 (27 residues), 22.2 bits, see alignment (E = 1.3e-08) amino acids 501 to 536 (36 residues), 35.8 bits, see alignment 6.9e-13

Best Hits

Swiss-Prot: 53% identical to EXAA_PSEAE: Quinoprotein alcohol dehydrogenase (cytochrome c) (exaA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00114, alcohol dehydrogenase (cytochrome c) [EC: 1.1.2.8] (inferred from 99% identity to rpf:Rpic12D_2100)

MetaCyc: 53% identical to alcohol dehydrogenase (cytochrome c550) monomer (Pseudomonas aeruginosa)
RXN-11333 [EC: 1.1.2.8]

Predicted SEED Role

"Quino(hemo)protein alcohol dehydrogenase, PQQ-dependent (EC 1.1.99.8)" (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.8 or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>ABZR87_RS15970 PQQ-dependent methanol/ethanol family dehydrogenase (Ralstonia sp. UNC404CL21Col)
MRTLRVIALAAAMAAASVAVHAATPPVTDAMIANDAKSSNDVLTWGMGTQGQRFSTLTKI
NTKNVSQLVPAWSFSFGGEKQRGQEAQPLIYNGKMFVTASYSRIYAIDLKTGTKLWKYEQ
RLPEGIMPCCDVVNRGAALYDNLVIFSTLDAQLIALNQDTGKIVWKEKIDDYAAGYSTTA
APLIVKGMVLTGVSGGEFGVVGRVEARDAKTGQLIWSRPTVEGHMGYKYDKDGNKTENGM
TGTLNASWPGETWKTGGASTWLGGTYDPQTNLVYFGTGNPGPWNSHLRKGDNLYSSSTLA
IDPDTGKIVWHYQNTPNDGWDFDGVNEFVTFDMDGKRVGGKADRNGFFYVNDAKTGKLLN
AFPFVKVNWATGIDLKTGRPNYASDHRPGDPAEAAGEEKKGKSVFAEPGFLGGKNQMPMA
YSPQTGLFYVPANEWGMDIWNEPVSYKKGAAYLGAGFTIKPLNEDYIGALRAINPKTGKI
EWQIKNNAPLWGGVMTTAGGLVFWGTPEGYLKAADAKTGKELWQFQTGSGIVAPPVTWED
KGEQFVAVVSGWGGAVPLWGGEVAKRVNFLEQGGSVWVFKLHKN