Protein Info for ABZR87_RS15960 in Ralstonia sp. UNC404CL21Col

Annotation: pyrroloquinoline quinone biosynthesis protein PqqE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 22 to 365 (344 residues), 523.6 bits, see alignment E=2.3e-161 PF04055: Radical_SAM" amino acids 33 to 187 (155 residues), 80.5 bits, see alignment E=1.7e-26 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 258 to 349 (92 residues), 34.5 bits, see alignment E=2.2e-12 PF13186: SPASM" amino acids 259 to 322 (64 residues), 35.8 bits, see alignment E=8.1e-13

Best Hits

Swiss-Prot: 60% identical to PQQE_ACIBC: PqqA peptide cyclase (pqqE) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 96% identity to rpi:Rpic_2492)

MetaCyc: 57% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ABZR87_RS15960 pyrroloquinoline quinone biosynthesis protein PqqE (Ralstonia sp. UNC404CL21Col)
MHSNAAGSFDAESLLAPAATPTPGPPLWLLAELTYRCPLHCAFCSNPVDYTQHDQELTTE
QWCDVFTQARALGAVQLGLSGGEPLLRKDLETLVAHAHALGFYVNLVTSGVGLTDARLGA
LRAAGLDHIQLSFQDSTRELNDFLSSTRTFDLKRRVADLIKAHGYPMVMNCVMHRHNLPH
IGAIIDMALEIGAEYLELANTQYYGWAWENRLALMPTLEQLRDAEAVVNDYRTRIGGRCQ
LLYVVPDYFEQRPKKCMNGWGTTFLGIAPDGVALPCHSARMLPGLELPNVLSQPLRDIWR
SSDAFQRFRGTHWMPEPCQSCESREEDAGGCRCQAYLLTGDATRTDPVCGKSADRGTLQT
VVLQGRMAAMNGFGHMRDTRTGEVPIVFRTDANSRRLTRP