Protein Info for ABZR87_RS15955 in Ralstonia sp. UNC404CL21Col

Annotation: pyrroloquinoline quinone biosynthesis peptide chaperone PqqD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03859: coenzyme PQQ biosynthesis protein PqqD
  • amino acids 11 to 89 (79 residues), 100.1 bits, E=2.4e-33
• PF05402: PqqD
  • amino acids 28 to 89 (62 residues), 56.7 bits, E=1.2e-19

Best Hits

Swiss-Prot: 46% identical to PQQD_PSEU5: PqqA binding protein (pqqD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 98% identity to rpf:Rpic12D_2097)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Protein Sequence (90 amino acids)

>ABZR87_RS15955 pyrroloquinoline quinone biosynthesis peptide chaperone PqqD (Ralstonia sp. UNC404CL21Col)
MNPPLSDPAHPTLHRTFRLQWEDMQQSWVLLYPEGMVTLNDSAAAILQRCDGAHTLDMLI
DDLQSAFGVQGIAPEVHAFVKHAFERGWLV