Protein Info for ABZR87_RS15950 in Ralstonia sp. UNC404CL21Col

Annotation: pyrroloquinoline-quinone synthase PqqC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 9 to 231 (223 residues), 338.2 bits, see alignment E=1.2e-105 PF03070: TENA_THI-4" amino acids 15 to 223 (209 residues), 159.5 bits, see alignment E=5.1e-51

Best Hits

Swiss-Prot: 64% identical to PQQC_ERWT9: Pyrroloquinoline-quinone synthase (pqqC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 98% identity to rpf:Rpic12D_2096)

MetaCyc: 65% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

"Pyrroloquinoline-quinone synthase (EC 1.3.3.11)" (EC 1.3.3.11)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>ABZR87_RS15950 pyrroloquinoline-quinone synthase PqqC (Ralstonia sp. UNC404CL21Col)
MTHPVAWTAEEFEARLRAKQAGYHIHHPFNLRMRAGECTPEEIRTWVANRFYYQVNIPLK
DAAILSNCPDRATRREWIVRIHDHDGDDAQPGGIESWLRLGVAVGLTRDALWSHRHLLPG
VRFAVDAYVNFARRAPWQEAVCSSLTEMFAPDIHKERLAGWPDHYPWVQPDGLAYFRSRI
PLASRDVEHGLRVTLDYFRTPEQQQRALDILQFKLDILWSMLDAIQQAHAHEPALV