Protein Info for ABZR87_RS15945 in Ralstonia sp. UNC404CL21Col

Annotation: pyrroloquinoline quinone biosynthesis protein PqqB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR02108: coenzyme PQQ biosynthesis protein B" amino acids 5 to 305 (301 residues), 396.1 bits, see alignment E=4.6e-123 PF12706: Lactamase_B_2" amino acids 51 to 272 (222 residues), 158.6 bits, see alignment E=7.9e-51

Best Hits

Swiss-Prot: 78% identical to PQQB_CUPNH: Coenzyme PQQ synthesis protein B (pqqB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 98% identity to rpi:Rpic_2489)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABZR87_RS15945 pyrroloquinoline quinone biosynthesis protein PqqB (Ralstonia sp. UNC404CL21Col)
MTILRVLGSAAGGGFPQWNCNCRNCDGVRRGTVRATPRTQSSIALGDGQHNWIVVNASPD
ILAQLRSSPALQPARTPRDTGIVGVVLMDAQIDHVTGLLMLREHRQALPVYASAAVISDL
STAFPLTRMLSHYCGLDTRALALDGTAFSVPPLDDVALTAIPLESKAPPYSPSRNARRVG
DNIGLRIVDRKSGRRAFYAPGLARVEPHVFDEMGAADVVLVDGTCWQDDEMLALGFSTKT
AADMGHLAQSGPGGMIDVLDQLPATRKVLIHINNTNPILDEESPQRRELEAHGIEVAYDG
MEISL