Protein Info for ABZR87_RS15930 in Ralstonia sp. UNC404CL21Col

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF01590: GAF" amino acids 75 to 204 (130 residues), 50.3 bits, see alignment E=1.1e-16 PF00158: Sigma54_activat" amino acids 347 to 509 (163 residues), 225.3 bits, see alignment E=1.1e-70 PF14532: Sigma54_activ_2" amino acids 349 to 515 (167 residues), 70.8 bits, see alignment E=4.3e-23 PF07728: AAA_5" amino acids 366 to 488 (123 residues), 22.7 bits, see alignment E=2.5e-08 PF02954: HTH_8" amino acids 628 to 667 (40 residues), 51.8 bits, see alignment 1.7e-17 PF13556: HTH_30" amino acids 639 to 667 (29 residues), 27.8 bits, see alignment (E = 5.1e-10)

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_2092)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>ABZR87_RS15930 sigma-54-dependent Fis family transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MTPHAAPGPRASDNAPATLGDAPHDQPELIAQSHERSKSYGLRPYESPDFCPVLHSELKT
EIERSQSLFTHALPVMETLYSQIVNTQSMVILTDTSGLILHSMGDDDFLAQASKVALQPG
ALWSEASRGTNAIGTALADGKPTLVHGSEHYLQANQFLTCSCAPIFDPYGATVGALDVTG
DHRGFHKHTMALVRMSAQMIENQLFANTFQDVVCIHFHSRPEFIGTLVEGIAAFTPAGRF
LSANRSGEFQLGLSIRALHAHTFSSLFGLSMSQLIDRERTAAAGIVQLQLPSGVKVFARV
EWKQLANRMVGGAMGADLSADRDSTPRRAYIEPPRQPASLEALDTGDAQIQTVIGKLRKV
IGKDIPVMVLGETGTGKELLARAIHADSPRHAGPFIAVNCASIPEALIESELFGYEEGAF
TGARKKGGIGKMVLANGGTLFLDEIGDMPLHLQARLLRALQERAVSPLGSNKLIQVDVTV
VCATHRNMREMVASGQFREDLYYRLNGLVVRLPALRERTDLDVVADKLLKLEQADAPPIS
EAVMQMFRSYHWPGNIRQLGNLLRTARLMAEGAPEITEDHLPDDFLEDWQARHGDQPAAN
VAGAGAGAVAAAAPPVAQTVGGTQPKRLADVESMAIMAAVKAHNGNISAAAKALGISRNT
IYRRIDEAGGLPSDTD