Protein Info for ABZR87_RS15865 in Ralstonia sp. UNC404CL21Col

Annotation: PelD GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details PF16963: PelD_GGDEF" amino acids 371 to 495 (125 residues), 146.3 bits, see alignment E=2.2e-47

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_2471)

Predicted SEED Role

"Extracellular Matrix protein PelD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>ABZR87_RS15865 PelD GGDEF domain-containing protein (Ralstonia sp. UNC404CL21Col)
MKTESAGSAQSASASASASAGRVAPDAGGQGGRNERRRNAQGIGASTWYGRLIAPAVSSP
SAVLETLGAVVAAIGIVWLFVPDNPLLLGYGFPWMWLVPLILALRYGTLLGALAALVVLG
AWAVFYGQTAAAGSFPRMYFLGGLMLVLIGGQYGDIWGARLSRARTVNGYLNDRLAALTK
NHFLLRLSHERLENDLLAKPTTLRDTLTQLRNIALAAREHGAGDNAPDVAQLPGAEPFLQ
WTAQACQLEVAAMVRVTGNRIDTEPVARVGTPFDIVADDPLIRHCIDTHTLGHPQAPELR
NVNNPEDSSRYVACAPVLSGADELIGLLVVHQMPFLSLSYENLQFLLVLLGYYADGVRHL
TVSSEILDLVPDAPYEFALDLGRLARLHRDTGIDSSVVALIFDKDETSDALFESVVRSRR
ALDVVWQANGKNRRAIITLMPLSGAGAVSAYLVRIEDSLRAQFGVDFEGGRISVQTLHVT
GEHPGEALQRFLSRCHLDA