Protein Info for ABZR87_RS15850 in Ralstonia sp. UNC404CL21Col

Annotation: exopolysaccharide Pel transporter PelG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 53 (33 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details PF16933: PelG" amino acids 1 to 453 (453 residues), 557.9 bits, see alignment E=9.5e-172

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_2075)

Predicted SEED Role

"Extracellular Matrix protein PelG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>ABZR87_RS15850 exopolysaccharide Pel transporter PelG (Ralstonia sp. UNC404CL21Col)
MAGIGFELRKMLKRDSLLGLLRAYTYAGIISSGPWILSIVGILLIGILSLPFVIPGSLIT
QFQVSVTYLIAISLILTGPLQLAFTRFTSDRLFEKRDDLILPNYHAVSLVMTLVAGGLGL
LVILFAFPQQSAIYRLLMLAGFVVMANIWIAVIFLSGMKQYKAIVWIFLIGYTLTVLLAL
LFNRLGLEGLLLGFVTGQLCLLIGMAALIYRNFSGRRFLSFEVFDRRFAYPSLMLIGLLY
NLGIWLDKFMFWYAPGTGQQVIGPLNASVIYDIPVFLAYLGIIPGMAVFLVRIETDFVEY
YDAFYDAVRGGASLEHIEDMRNTMVQTIRAGLYEIVKIQAMAALVLFAVGASVLRALQIS
ELYLPLLYVDTIAASLQVVFLGVVNIFFYLDRRRVVLALTAAFVVLNGALTWMTLQLGPA
WYGYGFAVSLLLVVMASLVILDRKLDRLEYETFMLQ