Protein Info for ABZR87_RS15830 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00005: ABC_tran" amino acids 21 to 167 (147 residues), 126.8 bits, see alignment E=1.5e-40 PF13401: AAA_22" amino acids 30 to 191 (162 residues), 31.2 bits, see alignment E=3.6e-11

Best Hits

Swiss-Prot: 64% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to rpi:Rpic_2465)

MetaCyc: 59% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"GlnQ"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ABZR87_RS15830 amino acid ABC transporter ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MNMITIEHVDKWYGDYHALVDINETVAKGEVVVVCGPSGSGKSTLIRTLNRLEAIQKGRI
VVNGHEVHAPGVDVNVLRSGIGFVFQQFNLFPHLTVMQNCTLAPVQLKRMAPQEAKDFAM
SLLERVGLPHKAGAYPGELSGGQQQRVAIARALAMKPPVMLFDEPTSALDPEMVNEVLLV
MKDLARDGMTMVCVTHEMGFAREVADRVLFMDQGQVLERATPEDFFQRPQHPRAQRFLAD
IRSPWSEPA