Protein Info for ABZR87_RS15800 in Ralstonia sp. UNC404CL21Col

Annotation: 3-oxoacid CoA-transferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 1 to 221 (221 residues), 391.2 bits, see alignment E=5.6e-122 PF01144: CoA_trans" amino acids 9 to 218 (210 residues), 239.5 bits, see alignment E=1.4e-75

Best Hits

Swiss-Prot: 75% identical to PCAI_PSEPU: 3-oxoadipate CoA-transferase subunit A (pcaI) from Pseudomonas putida

KEGG orthology group: K01031, 3-oxoadipate CoA-transferase, alpha subunit [EC: 2.8.3.6] (inferred from 97% identity to rpi:Rpic_2459)

MetaCyc: 82% identical to adipate CoA-transferase alpha subunit (Cupriavidus necator H16)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.6, 6.2.1.5

Use Curated BLAST to search for 2.8.3.6 or 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>ABZR87_RS15800 3-oxoacid CoA-transferase subunit A (Ralstonia sp. UNC404CL21Col)
MINKLCPSVEAALADIPDGATIMIGGFGTAGMPSELIDGLIAHGARELTIINNNAGNGET
GLAALLKARRVRKIVCSFPRQADSYVFDALYRAGEIELELVPQGNLAERIRAAGAGIGGF
FCPTAYGTQLAEGKETRIIDGKPYVFELPLTADYALIKALRADRWGNLVYRKTARNFGPV
MAMAAKCTIAQVSETVELGELDPEHIVTPGIFVKRVVKLGNAAQAKEAA