Protein Info for ABZR87_RS15655 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF00892: EamA" amino acids 24 to 154 (131 residues), 31.3 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_2037)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>ABZR87_RS15655 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MPAHTATAAPTATQTAESSSRQSLWMILAAFAFSAMGVCVKLASAYYSTGEIVFYRSVIG
MTVMGAILAKTGAGIRTPYLTAHIKRSVFGVTSLLLWFTSISLLPLATAMTLNYMSPVWI
ALIIGAGAAMAGKAAGADKKMVAAILMSFVGVLCLLQPSVGSGPSQLAGGMVGLVSGVFT
ALAYVEVRQLGDLGENEARIVFYFSLVSAIAGGVWMLIGGAQSHTWHSAGLLLAVGLLAT
LGQTAMTRAYKRGNTLLTANLQYTGIVFASGWGMLLWNDHLNALSWAGMALIIGSGIVTT
VMRARQSGNEHPTPQTAVSGPEAEIHPEV