Protein Info for ABZR87_RS15640 in Ralstonia sp. UNC404CL21Col

Annotation: polyprenyl synthetase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00348: polyprenyl_synt" amino acids 31 to 266 (236 residues), 185.2 bits, see alignment E=6.5e-59

Best Hits

Swiss-Prot: 56% identical to ISPA_BRADU: Probable farnesyl diphosphate synthase (fppS) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00795, farnesyl diphosphate synthase [EC: 2.5.1.1 2.5.1.10] (inferred from 92% identity to rsc:RCFBP_11172)

MetaCyc: 52% identical to geranyl diphosphate/farnesyl diphosphate synthase (Escherichia coli K-12 substr. MG1655)
Geranyltranstransferase. [EC: 2.5.1.10]; Dimethylallyltranstransferase. [EC: 2.5.1.10, 2.5.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.1 or 2.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>ABZR87_RS15640 polyprenyl synthetase family protein (Ralstonia sp. UNC404CL21Col)
MSDFAQWMASVVARTESALEHTLPAETVAPQRLHAAMRYATLGAGKRVRPLLAHAAGALG
DASLEALDGVSCAVEMIHAYSLVHDDMPCMDDDDLRRGRPTVHRAYDEATALLVGDALQT
QAFIVLAELGALSPATRAVLVGELARASGSLGMAGGQAIDLQSVGIALSQDELEAMHRMK
TGALLRASLRMGALCAGVNAAALEHVDAYAGAVGLAFQVVDDILDVTADTATLGKTAGKD
EANDKPTYVSILGLDKARALADELHAAAGAAVAELARELGKARTVRLAEMADLIVRRGH