Protein Info for ABZR87_RS15635 in Ralstonia sp. UNC404CL21Col

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF13292: DXP_synthase_N" amino acids 6 to 282 (277 residues), 398.9 bits, see alignment E=3.3e-123 TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase" amino acids 7 to 623 (617 residues), 867.9 bits, see alignment E=2.1e-265 PF00676: E1_dh" amino acids 110 to 184 (75 residues), 38.8 bits, see alignment E=1.7e-13 PF02775: TPP_enzyme_C" amino acids 116 to 178 (63 residues), 23.6 bits, see alignment E=1.2e-08 PF02779: Transket_pyr" amino acids 318 to 479 (162 residues), 163.3 bits, see alignment E=1.4e-51 PF02780: Transketolase_C" amino acids 507 to 616 (110 residues), 88.2 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 99% identical to DXS_RALPJ: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 99% identity to rpi:Rpic_2426)

MetaCyc: 57% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>ABZR87_RS15635 1-deoxy-D-xylulose-5-phosphate synthase (Ralstonia sp. UNC404CL21Col)
MTYELLNTIDDPADLRRLDRRQLGPLANELRAFVLDSVSQTGGHLSSNLGTVELTIALHY
VFNTPEDRIVWDVGHQSYPHKILTGRRDQMGSLRQLDGISGFPRRSESPYDTFGTAHSST
SISAALGMALGAKTNGEDRVAIAVIGDGAMSAGMAFEAMNNAGVYKDLPLVVVLNDNDMS
ISPPVGALNRYLARLMSGQFYAATKKGVEKLLSVAPPVLEFAKRFEEHTKGMFVPATMFE
EFGFNYIGPIDGHDLESLVPTLQNIRQRAREGGGPQFLHVVTKKGQGYKLAEADPILYHG
PGKFNPQEGIKPSGRPAKVTYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFP
DRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDR
AGLVGADGATHAGAYDIAYLRCIPNMMVMTPADENECRQLLSTAFAQDCPTAVRYPRGAG
TGVAVQPTLEPLPLGKAEVRHASAAPAGQRVAILAFGSMVAPASAAAERLDATVVNMRFV
KPLDVACVLEMARTHDYVVTVEEGCVMGGAGSACLEALAAAGIATPVLQLGLPDRFVDHG
DHAALLAQCGLDANGILASIRERFAVQPRAAAPRVA