Protein Info for ABZR87_RS15635 in Ralstonia sp. UNC404CL21Col

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 6 to 282 (277 residues), 397.5 bits, E=9.2e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 7 to 623 (617 residues), 867.9 bits, E=2.1e-265
• PF00676: E1_dh
  • amino acids 110 to 184 (75 residues), 38.8 bits, E=1.7e-13
• PF02775: TPP_enzyme_C
  • amino acids 116 to 178 (63 residues), 23.6 bits, E=1.2e-08
• PF02779: Transket_pyr
  • amino acids 318 to 479 (162 residues), 163.3 bits, E=1.4e-51
• PF02780: Transketolase_C
  • amino acids 507 to 616 (110 residues), 88.2 bits, E=1.2e-28

Best Hits

Swiss-Prot: 99% identical to DXS_RALPJ: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 99% identity to rpi:Rpic_2426)

MetaCyc: 57% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (636 amino acids)

>ABZR87_RS15635 1-deoxy-D-xylulose-5-phosphate synthase (Ralstonia sp. UNC404CL21Col)
MTYELLNTIDDPADLRRLDRRQLGPLANELRAFVLDSVSQTGGHLSSNLGTVELTIALHY
VFNTPEDRIVWDVGHQSYPHKILTGRRDQMGSLRQLDGISGFPRRSESPYDTFGTAHSST
SISAALGMALGAKTNGEDRVAIAVIGDGAMSAGMAFEAMNNAGVYKDLPLVVVLNDNDMS
ISPPVGALNRYLARLMSGQFYAATKKGVEKLLSVAPPVLEFAKRFEEHTKGMFVPATMFE
EFGFNYIGPIDGHDLESLVPTLQNIRQRAREGGGPQFLHVVTKKGQGYKLAEADPILYHG
PGKFNPQEGIKPSGRPAKVTYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFP
DRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDR
AGLVGADGATHAGAYDIAYLRCIPNMMVMTPADENECRQLLSTAFAQDCPTAVRYPRGAG
TGVAVQPTLEPLPLGKAEVRHASAAPAGQRVAILAFGSMVAPASAAAERLDATVVNMRFV
KPLDVACVLEMARTHDYVVTVEEGCVMGGAGSACLEALAAAGIATPVLQLGLPDRFVDHG
DHAALLAQCGLDANGILASIRERFAVQPRAAAPRVA