Protein Info for ABZR87_RS15625 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 318 (316 residues), 442.2 bits, see alignment E=1e-136 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 311 (308 residues), 375.6 bits, see alignment E=1.9e-116 PF00814: TsaD" amino acids 25 to 312 (288 residues), 328.6 bits, see alignment E=1.8e-102

Best Hits

Swiss-Prot: 98% identical to TSAD_RALPJ: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 98% identity to rpi:Rpic_2424)

MetaCyc: 59% identical to N6-L-threonylcarbamoyladenine synthase, TsaD subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234 or 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>ABZR87_RS15625 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD (Ralstonia sp. UNC404CL21Col)
MLVLGIESSCDETGVALYDTHAGLRAHALYSQIAMHREYGGVVPELASRDHIRRVIPLLE
EVLAKAGATRADIDAIAYTKGPGLAGALLVGASVANALAFALGKPLVGVHHLEGHLLSPL
LEADRPEFPFLALLVSGGHTQLMRVDAVGQYTLLGETLDDAAGEAFDKTAKLLGLGYPGG
PAVSRLAEFGNPGVFDLPRPMLHSGNFDFSFAGLKTAVLTQVRKLNLTDSQACHQPRADL
ARAFVDAIVEVLVKKTLRAAREHGLKRIVVAGGVGANRQLREGLNAEGKKRGLRVYYPDL
QFCTDNGAMIAFAGAMRLQADPAQVQDGYGYGVTPRWDLEDIRIHQA