Protein Info for ABZR87_RS15600 in Ralstonia sp. UNC404CL21Col

Annotation: RNA polymerase sigma factor RpoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 PF03979: Sigma70_r1_1" amino acids 156 to 235 (80 residues), 93.7 bits, see alignment E=1.6e-30 PF00140: Sigma70_r1_2" amino acids 252 to 284 (33 residues), 50 bits, see alignment (E = 7e-17) PF04546: Sigma70_ner" amino acids 293 to 508 (216 residues), 220.1 bits, see alignment E=9.8e-69 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 535 to 760 (226 residues), 129.8 bits, see alignment E=7.5e-42 TIGR02393: RNA polymerase sigma factor RpoD" amino acids 535 to 771 (237 residues), 392.6 bits, see alignment E=6.4e-122 PF04542: Sigma70_r2" amino acids 541 to 609 (69 residues), 80.1 bits, see alignment E=2.4e-26 PF04539: Sigma70_r3" amino acids 618 to 694 (77 residues), 89.3 bits, see alignment E=4.4e-29 PF04545: Sigma70_r4" amino acids 707 to 760 (54 residues), 66.9 bits, see alignment 2.7e-22

Best Hits

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 98% identity to rpf:Rpic12D_2027)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (774 amino acids)

>ABZR87_RS15600 RNA polymerase sigma factor RpoD (Ralstonia sp. UNC404CL21Col)
MSTSARPGGTAASVALKGKTTTVAKSKVTEVESKQTTASASATKTGTARTSTAAKPAKAT
AEDTKRTAQAGATPTTPPAPRAEVAAEPKKRGRKPKAETQADDDSSTDVTEEFDTPAAPA
PKTEKLKARDRKAKEKALLKEFAASQQGGSEEELEARRQKLKALIKLGKSRGYLTYAEIN
DHLPDDMVDVESMETLVATLNDIGVAVYEQAPDAETLLLNDNAPSVTTEEEAEEEAEAAL
STVDSEFGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEAGLKDMVMAISACPVTISEI
LAMGERVANDESKIDEFIDGLIDPNAEAEAAAAAEEEEEFEEEDAEEEGDEEEDEDDEGA
GAAAASARQLEELKQAALVKFGVIGEQFDKMRRAFEKEGYKSKPYVKAQEAIQAELMTIR
FTARNVERLCDTLRGQVDEVRKLERAILNIVVDKCGMPRGDFVARFPGNETNLKWIETVV
ADGKPYSTIVERNVPAVHELQQKLIDLQARVVLPLTELKDVNRKMSEGERRAREAKREMT
EANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAIT
RSIADQARTIRIPVHMIETINKMNRISRQILQETGNEPDPATLAEKMEMPEDKIRKIMKI
AKEPISMETPIGDDDDSHLGDFIEDTNTLAPAEAALHGSMRGVVKDVLDSLTPREAKVLR
MRFGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGS