Protein Info for ABZR87_RS15495 in Ralstonia sp. UNC404CL21Col

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 199 to 347 (149 residues), 75.3 bits, see alignment E=2.4e-25

Best Hits

KEGG orthology group: None (inferred from 91% identity to rpf:Rpic12D_2006)

Predicted SEED Role

"FIG01270238: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABZR87_RS15495 O-antigen ligase family protein (Ralstonia sp. UNC404CL21Col)
MSGLMQRGRTLIASAPAALAVFGISILPAFMLSVRGAAFLSFLLLLVAAFWSMLAAPAEV
FSRLRTMWREHRWLILAMAAMPTAMLISAQLNPAAPRSVPFAYGRLWLFGLALFALLQLR
PKQLESVQWGCVAGALASVVWAYLELRIGRPDKIGAFANTIPFGNLSLLMGLFSLISIGW
SKEDGWPLIALRLAGGGAGLFASYMSQSRGGWVAIPVLLLIAVATLRHVSWKKRVAALLV
FFALLAAVCVSSSMVRARFDQAVSDLHAYQAGQTNTSVGIRFQLWRAATLMLTRHPLAGV
GRGQFEPALKAIHAEGLITREATAFEHAHNEFLYNGATLGVLGIGALLALYLVPAAYFLR
AALCDDRILRTTGAMGLTLCVGFLLFGLTEVMLIIAQTVVFYSVMVAVFTAHIHRRRQQL
GAAPVF