Protein Info for ABZR87_RS15395 in Ralstonia sp. UNC404CL21Col

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 12 to 215 (204 residues), 250.6 bits, E=5.9e-79
• PF14681: UPRTase
  • amino acids 13 to 214 (202 residues), 251.4 bits, E=2.9e-79

Best Hits

Swiss-Prot: 99% identical to UPP_RALPJ: Uracil phosphoribosyltransferase (upp) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 99% identity to rpi:Rpic_2386)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• pyrimidine nucleobases salvage II (1/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (216 amino acids)

>ABZR87_RS15395 uracil phosphoribosyltransferase (Ralstonia sp. UNC404CL21Col)
MKQDPRFPNLFILNHPLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPLTSRH
IDTPMGPMEAPVIAGRKLAVVPVLRAGVGMSDGLVELIPSARIGHIGVYRDDQHRPVEYL
VRLPDLEDRTFILCDPMVATGYSAVHAVDVMKKRGVPDENILFLALVAAPEGVEVFQQAH
PGVKLFVASLDSHLDENAYIIPGLGDAGDRLFGTKN