Protein Info for ABZR87_RS15355 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 263 (256 residues), 114.1 bits, see alignment E=3.3e-37

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 98% identity to rpi:Rpic_2378)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABZR87_RS15355 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MDSLAPLIAASINAGTPLLLAALGLLMNERSGVLNLGAEGMMLVAAVVGFMVGYQTQTPL
LGFAAGAIAGMVMASLFAWLALVLVTNQVATGLALSIFGTGLSAFMGQRFVGMSLPAQAH
GIPGLESIPFVGPALFAHHWMVYFSLLLCGAIAWFLFKTRAGLTLRAIGESPESAHALGF
PVRTVRFGALLFGGACCGLAGAYLSLVYTPMWVENMVAGRGWIALALTTFATWRPLRILF
GALLFGGVTILQFHLQGMGVSVPSQILSMAPFAATIVVLAIISRNPDWIRLNMPASLGKP
FRPGAA