Protein Info for ABZR87_RS15335 in Ralstonia sp. UNC404CL21Col

Annotation: 5-oxoprolinase subunit PxpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02682: CT_C_D
  • amino acids 4 to 200 (197 residues), 247.6 bits, E=4.7e-78
• TIGR00370: sensor histidine kinase inhibitor, KipI family
  • amino acids 8 to 209 (202 residues), 261.4 bits, E=2.2e-82

Best Hits

Swiss-Prot: 46% identical to PXPB_HAEIN: 5-oxoprolinase subunit B (pxpB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_1974)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea degradation I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Protein Sequence (215 amino acids)

>ABZR87_RS15335 5-oxoprolinase subunit PxpB (Ralstonia sp. UNC404CL21Col)
MQCTIHRLGELALLCEVPPPATLNCQQRIWAMASRASNWAGVVDVVPGMNNLTLVFGPLA
DAQRLTTQLREAWEESQALVADGKLVDIEVAYGGDEGPDLREVAKHTGLSTAEVVRRHTA
PEYIVYFLGFQPGFAYMGGLDKSLATPRRAEPRMAVPAGSVGIGGEQTGIYPAASPGGWQ
LLGRTDAALFIPQRNPPTLLAPGDRIRFVASKVRA