Protein Info for ABZR87_RS15330 in Ralstonia sp. UNC404CL21Col

Annotation: biotin-dependent carboxyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00724: biotin-dependent carboxylase uncharacterized domain
  • amino acids 8 to 329 (322 residues), 362.9 bits, E=6.2e-113
• PF02626: CT_A_B
  • amino acids 31 to 303 (273 residues), 335 bits, E=1.9e-104

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_2373)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea degradation I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Protein Sequence (349 amino acids)

>ABZR87_RS15330 biotin-dependent carboxyltransferase family protein (Ralstonia sp. UNC404CL21Col)
MSSKPQPMIEIVRAGVLASVQDLGRTGYRRFGVCTSGALDPLSLYVGNRLVGNRSDAAGI
EFTLGNATLRFHANGLIALTGADCRATLDGAPVHAWRAIPVQRGQMLTLRVAQGGVRAYL
CVAGGIDVPEMMGSRSTDLKAGFGGFEGRPLKDGDRLPVLPADTTYAPDISGDTVAVKAA
RWTFDRAQKDTPVMRVLPGPEYDDFVADAQAAFWESDWTLTPNSNRMGFRLQGPELQRKK
QRSGDLLSHGVVPGVIQVPPSGQPIVLMADAQTTGGYPKIGSVILADQWRLAQIPLGTRV
RFERVTLEEAEAARADVARYLQQIETALDWQRQGILSSAHRTAKTRLNA