Protein Info for ABZR87_RS15330 in Ralstonia sp. UNC404CL21Col

Annotation: biotin-dependent carboxyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00724: biotin-dependent carboxylase uncharacterized domain" amino acids 8 to 329 (322 residues), 362.9 bits, see alignment E=6.2e-113 PF02626: CT_A_B" amino acids 31 to 303 (273 residues), 335 bits, see alignment E=1.9e-104

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_2373)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>ABZR87_RS15330 biotin-dependent carboxyltransferase family protein (Ralstonia sp. UNC404CL21Col)
MSSKPQPMIEIVRAGVLASVQDLGRTGYRRFGVCTSGALDPLSLYVGNRLVGNRSDAAGI
EFTLGNATLRFHANGLIALTGADCRATLDGAPVHAWRAIPVQRGQMLTLRVAQGGVRAYL
CVAGGIDVPEMMGSRSTDLKAGFGGFEGRPLKDGDRLPVLPADTTYAPDISGDTVAVKAA
RWTFDRAQKDTPVMRVLPGPEYDDFVADAQAAFWESDWTLTPNSNRMGFRLQGPELQRKK
QRSGDLLSHGVVPGVIQVPPSGQPIVLMADAQTTGGYPKIGSVILADQWRLAQIPLGTRV
RFERVTLEEAEAARADVARYLQQIETALDWQRQGILSSAHRTAKTRLNA