Protein Info for ABZR87_RS15285 in Ralstonia sp. UNC404CL21Col

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR00229: PAS domain S-box protein" amino acids 11 to 123 (113 residues), 63.1 bits, see alignment E=1.4e-21 PF13188: PAS_8" amino acids 11 to 61 (51 residues), 40.2 bits, see alignment E=6.9e-14 PF00989: PAS" amino acids 12 to 93 (82 residues), 55.2 bits, see alignment E=2.1e-18 PF08448: PAS_4" amino acids 14 to 98 (85 residues), 46.4 bits, see alignment E=1.3e-15 PF13426: PAS_9" amino acids 17 to 93 (77 residues), 35.4 bits, see alignment E=3.3e-12 PF08447: PAS_3" amino acids 31 to 99 (69 residues), 40.8 bits, see alignment E=6.8e-14 PF00196: GerE" amino acids 133 to 184 (52 residues), 39.2 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_2364)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>ABZR87_RS15285 PAS domain S-box protein (Ralstonia sp. UNC404CL21Col)
MEVLKDVSAIALANSLPDGVFLVDERGRIRHANAAWEDILGYRPSDLLGQTMLELVAPDD
RDRTQKQAGRVQAGIKCTGFENRYRHQLGTDVHLSWSAQWNVEHRLRIGVARNVTATRTA
AERSPLAQLQARLAPHESRVLQLLLTEAAEKQIAEQLGLATSTTHSYITSVYRKFGVRGR
AGLMSLWLKEMQSR