Protein Info for ABZR87_RS15020 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 844 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 271 to 291 (21 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details amino acids 433 to 458 (26 residues), see Phobius details amino acids 484 to 504 (21 residues), see Phobius details amino acids 719 to 740 (22 residues), see Phobius details amino acids 772 to 796 (25 residues), see Phobius details amino acids 808 to 829 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 26 to 217 (192 residues), 32.5 bits, see alignment E=1.1e-11 PF02687: FtsX" amino acids 274 to 388 (115 residues), 45.9 bits, see alignment E=5.3e-16 amino acids 723 to 836 (114 residues), 55.4 bits, see alignment E=6.2e-19

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 97% identity to rpi:Rpic_2242)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (844 amino acids)

>ABZR87_RS15020 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MSRFSVWTQALRMLRRDWRAGELNLLLVALVLAVAALASVSFLADRMHAGLERDARQLIG
ADVLVVSDQPLPPDIEAYARASGLQVTHTATFPSMASTLTKGASGEPASQLAAIKAVDVG
YPLRGTLKVSDDGRDTAGAPIRGIPAAGTVWVDAPLLEALGLRVGDAIRLGTRTFKIAHV
ITQELDRGAGFMNFAPRVMLPMSDLGSTGLVTYGSRVTYRLLVAGPDAAAGAFHTWAENE
AKTRQLRGVRVESLQNGQPQMRETLDRAERFLSLVALLAAMIAAVAITMAARRYTARHTD
AVAVIKCLGLKQGQILGTFALEFLLIGVIGSAVGVALGYGAHWLLLASLGDLVTVTLPAP
SIWPAVVGVTAGLVLLIGFAVPPLLSLVRVAPLRVLRRDVAERAVAAWIGYALGAAAFFA
LLVVSARDVKLGALTAAGFAGAIVVFALLAAGGLRALAMSLGRGRALSVGWRFALAVLER
RRGVSVLQTVALAVGLMALLLLAMTRNDLIRSWHNATPADAPNRFIINIQPDQMQAVAQA
LAQAGVADPKLYPMVRGRLTQVNGQVIDRQTYAESRARNLVEREFNLSYATAQPPENRIV
SGQWFSGQKPEASVEEGIAKTLNLHLGDVLRFDVAGQTVDAPITSLRKLDWSSMRVNFFV
ILPPVALRDMPQTYVTAFRIPAGHADLPAKLVREFPNLTVVDTELILQQVQGVLDQVTAA
VEFLFVFTLAAGVLVLYAALSGSRDERLRDAGVLRALGASSGVVRQTQYAEVLIVGGLAG
LMAGVGAIAIGWVLSAYVFDFPYRFNPAILPVGIVSGMACAFIGGWLGLRDVLRRPAMAT
LRDA