Protein Info for ABZR87_RS14940 in Ralstonia sp. UNC404CL21Col

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 9 to 213 (205 residues), 235.8 bits, E=1.6e-74
• PF02666: PS_Dcarbxylase
  • amino acids 44 to 211 (168 residues), 154.5 bits, E=1.4e-49

Best Hits

Swiss-Prot: 100% identical to PSD_RALPJ: Phosphatidylserine decarboxylase proenzyme (psd) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 99% identity to rpf:Rpic12D_1902)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (215 amino acids)

>ABZR87_RS14940 phosphatidylserine decarboxylase (Ralstonia sp. UNC404CL21Col)
MNNTYPHPIIAREGWPYLGGIFIVTLIVQAAAGFGWAWPFWVLTLFVLQFFRDPARAVPT
QANAILSPADGRIVAVEQVRDPYADRDSLKISVFMNVFNVHSNRAPVDGTVQQVQYFPGK
FVNADLDKASLENERNAIVLRRADGQLVTSVQVAGLIARRILCYTKAGEVLTRGQRYGFI
RFGSRVDVYLPLTARPRVTIGEKVSATLTVLAELD