Protein Info for ABZR87_RS14880 in Ralstonia sp. UNC404CL21Col

Annotation: NADH-quinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details PF00507: Oxidored_q4" amino acids 22 to 118 (97 residues), 131.1 bits, see alignment E=7.2e-43

Best Hits

Swiss-Prot: 100% identical to NUOA_RALPJ: NADH-quinone oxidoreductase subunit A (nuoA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 97% identity to rsc:RCFBP_11326)

MetaCyc: 37% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>ABZR87_RS14880 NADH-quinone oxidoreductase subunit A (Ralstonia sp. UNC404CL21Col)
MNLEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVR
YYLIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE