Protein Info for ABZR87_RS14860 in Ralstonia sp. UNC404CL21Col

Annotation: NADH-quinone oxidoreductase subunit NuoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 9 to 157 (149 residues), 218.1 bits, E=2.8e-69
• PF01257: 2Fe-2S_thioredx
  • amino acids 11 to 156 (146 residues), 170.5 bits, E=1e-54

Best Hits

Swiss-Prot: 43% identical to NUOE_RICFE: NADH-quinone oxidoreductase subunit E (nuoE) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 98% identity to rsl:RPSI07_1371)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (167 amino acids)

>ABZR87_RS14860 NADH-quinone oxidoreductase subunit NuoE (Ralstonia sp. UNC404CL21Col)
MLSAEALKEIDRAVAKYPADQKQSAVMAALAVAQSEKGWVSPEVMQFVAEYLEMPPVWVE
EVATFYNMYDTKPVGRFKLSVCTNLPCALSGGERAADYLKKKLGIGFNETTADGNFTLKE
GECMGACGDAPVMIVNNTHMCSFMSNEKLDALIADLQSKAPTNGAGK