Protein Info for ABZR87_RS14845 in Ralstonia sp. UNC404CL21Col

Annotation: NADH-quinone oxidoreductase subunit NuoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 253 to 278 (26 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details PF00146: NADHdh" amino acids 26 to 343 (318 residues), 415.4 bits, see alignment E=7.3e-129

Best Hits

Swiss-Prot: 100% identical to NUOH_RALPJ: NADH-quinone oxidoreductase subunit H (nuoH) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to rpi:Rpic_2207)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABZR87_RS14845 NADH-quinone oxidoreductase subunit NuoH (Ralstonia sp. UNC404CL21Col)
MIESITSFGTATFGGWWPLIWTLVRAVCIILPLLLCVAYLILWERKLIGWMHVRLGPNRV
GPMGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVIPFQAEAMVSNI
NAGLLYVMAISSVGVYGVILAGWASNSKYAFLGAMRASAQMISYEIAMGFALVTVLMVTG
SLNLSDIVNSQNRGFFAGHGINILSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEI
VAGHMIEYSGMAFALFFLAEYINMIVISALTATLFLGGWASPIDAPVLNWIPGFFWLLIK
VFLLLSVFIWLRASFPRYRYDQIMRLGWKIFIPLTVGWLVVVAIWLVSPWNIWK