Protein Info for ABZR87_RS14825 in Ralstonia sp. UNC404CL21Col

Annotation: NADH-quinone oxidoreductase subunit L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 226 to 242 (17 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details amino acids 494 to 516 (23 residues), see Phobius details amino acids 553 to 580 (28 residues), see Phobius details amino acids 662 to 684 (23 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 9 to 680 (672 residues), 809.2 bits, see alignment E=1.8e-247 PF00662: Proton_antipo_N" amino acids 76 to 126 (51 residues), 81.2 bits, see alignment 4e-27 PF00361: Proton_antipo_M" amino acids 142 to 424 (283 residues), 277.5 bits, see alignment E=1.2e-86

Best Hits

Swiss-Prot: 66% identical to NUOL_NEIMA: NADH-quinone oxidoreductase subunit L (nuoL) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 99% identity to rpf:Rpic12D_1880)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>ABZR87_RS14825 NADH-quinone oxidoreductase subunit L (Ralstonia sp. UNC404CL21Col)
MATTLNPNLLLAIPLAPLAGAAIAGLFGTKFFGEKIGRTASHSVTILGVAIAFILSALTL
SDVINGAGYNGTVYEWMTVGSLKMEVGFLIDSLTAMMMCVVTFVSLMVHIYTIGYMAEDD
GYNRFFAYISLFTFSMLMLVMSNNFLQLFFGWEAVGLVSYLLIGFWFKRPTAIYANMKAF
LVNRVGDFGFVLGIGLLLAYSGSLSYADVFAARDNLATIGFPGTDWHMLTVACICLFIGA
MGKSAQFPLHVWLPDSMEGPTPISALIHAATMVTAGIFMVARMSPLFELSDTALSFVLII
GAITALFMGFLGIIQTDIKRVVAYSTLSQLGYMTVALGASAYQVAVFHLMTHAFFKALLF
LGAGSVIIGMHHDQDMRNMGGLRKYMPITWLTSLVGSLALIGTPFFSGFYSKDSIIEAVR
ESHLPGAGFAYWAVLAGVFVTAFYSFRMYFLVFHGEERFGKAHAHHDDHHEEEEGDHDHH
HGLAPGQKPHESPWVVTVPLVLLAIPSVIIGAMAIQPMLFGEFFKHGVVFSEVIFNSENH
EAMKVLAEDFHGWVAMALHGFTSAPFILLVLGVVLSWFFYLKRPDIPAAIAKRFSGVYKL
LDNKYYMDKINEIVFANGAVKFGRGLWKGGDQGVIDGVVVNGSARLVGWFATVVRLLQSG
FIYDYAFAMIIGTVGLLTYFVFLAGK